Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 1020 (Olfr1020)

This Recombinant Mouse Olfactory receptor 1020 (Olfr1020) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Olfactory receptor 1020, Olfactory receptor 201-2

UniProt

Q8VFK7

Expression Region

1-317

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVRSGKGIQNKNATEVTEFILLGLSDNPDLQGVLFALFLIIYTMTLVGNLGMMALIKIDR SLHTPMYFFLSSLSFVDASYSSSVTPKMLVNLMAEDKSISFNGCATQFFFFGSFLGTECF LLAMMAYDRYAAIWNPLLYPVLMSGRICFMLVSTSFLAGFGNAAIHTGMTFRLSFCGSNK INHFYCDTPPLLKLSCSDTHINGIVIMAFSSFNVISCVLIVLISYLCILIAILKMPSAEG RHKAFSTCASHLMAVTIFFGTILFMYLRPTSSYSMEQDKVVSVFYTVVIPMLNPLIYSLK NKDVKKAVKKILHNYVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NRG1, Tag Free
HA210772-01 20 µg

Human NRG1, Tag Free

Sign In for Pricing
View Details
Human NRG1, Tag Free
HA210772-02 50 µg

Human NRG1, Tag Free

Sign In for Pricing
View Details
Human NRG1, Tag Free
HA210772-03 100 µg

Human NRG1, Tag Free

Sign In for Pricing
View Details
CF®488A Goat Anti-Mouse IgG3 (γ3), 2mg/mL
#20924-250uL 1x 250 µL

CF®488A Goat Anti-Mouse IgG3 (γ3), 2mg/mL

Sign In for Pricing
View Details
P Glycoprotein (ABCB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G7]
TA800920AM 100 µL

P Glycoprotein (ABCB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G7]

Sign In for Pricing
View Details
GNAI2 Rabbit Polyclonal Antibody
HA500293 100 µL

GNAI2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details