Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 10A5 (OR10A5)

This Recombinant Human Olfactory receptor 10A5 (OR10A5) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Olfactory receptor 10A5, HP3, Olfactory receptor 10A1, Olfactory receptor 11-403, OR11-403, Olfactory receptor-like protein JCG6

UniProt

Q9H207

Expression Region

1-317

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAIGNWTEISEFILMSFSSLPTEIQSLLFLTFLTIYLVTLKGNSLIILVTLADPMLHSPM YFFLRNLSFLEIGFNLVIVPKMLGTLLAQDTTISFLGCATQMYFFFFFGVAECFLLATMA YDRYVAICSPLHYPVIMNQRTRAKLAAASWFPGFPVATVQTTWLFSFPFCGTNKVNHFFC DSPPVLKLVCADTALFEIYAIVGTILVVMIPCLLILCSYTRIAAAILKIPSAKGKHKAFS TCSSHLLVVSLFYISSSLTYFWPKSNNSPESKKLLSLSYTVVTPMLNPIIYSLRNSEVKN ALSRTFHKVLALRNCIP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Smooth muscle
CS700044 5x 5 µm

Tissue FFPE Sections, Smooth muscle

Sign In for Pricing
View Details
PYCR3 (NM_023078) Human Recombinant Protein
TP303382 20 µg

PYCR3 (NM_023078) Human Recombinant Protein

Sign In for Pricing
View Details
Biotin Anti-Human CD40 Antibody[G28.5]
E-AB-F1214B-01 25 µg

Biotin Anti-Human CD40 Antibody[G28.5]

Sign In for Pricing
View Details
Biotin Anti-Human CD40 Antibody[G28.5]
E-AB-F1214B-02 100 µg

Biotin Anti-Human CD40 Antibody[G28.5]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Viscum album Lectin (Mistletoe) -VAA-, 1mL 40nm
GP-5401-40 1 mL

Colloidal Gold Conjugated Viscum album Lectin (Mistletoe) -VAA-, 1mL 40nm

Sign In for Pricing
View Details
Dehydro Ivabradine
TRC-D229135-5MG 5 mg

Dehydro Ivabradine

Sign In for Pricing
View Details