Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Adenosine receptor A3 (ADORA3)

This Recombinant Sheep Adenosine receptor A3 (ADORA3) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Adenosine receptor A3

UniProt

P35342

Expression Region

1-317

Origin

Ovis aries (Sheep)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVNSTAVSWTSVTYITVEILIGLCAIVGNVLVIWVVKLNPSLQTTTFYFIVSLALADIA VGVLVMPLAIVISLGVTIHFYSCLFMTCLMLIFTHASIMSLLAIAVDRYLRVKLTVRYRR VTTQRRIWLALGLCWLVSFLVGLTPMFGWNMKLSSADENLTFLPCRFRSVMRMDYMVYFS FFLWILVPLVVMCAIYFDIFYIIRNRLSQSFSGSRETGAFYGREFKTAKSLLLVLFLFAL CWLPLSIINCILYFDGQVPQTVLYLGILLSHANSMMNPIVYAYKIKKFKETYLLILKACV MCQPSKSMDPSTEQTSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Labeled HBsAg Recombinant Protein, 1mL 5nm
GM-601-5 1 mL

Colloidal Gold Labeled HBsAg Recombinant Protein, 1mL 5nm

Sign In for Pricing
View Details
Human NRIP3 activation kit by CRISPRa
GA111219 1 Kit

Human NRIP3 activation kit by CRISPRa

Sign In for Pricing
View Details
Cyclin E (G1/S-Phase Cyclin) (CCNE1/2587), CF647 conjugate, 0.1mg/mL
BNC472587-100 1x 100 µL

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2587), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Buccutite™ Rapid PE-Cy5.5 Tandem Antibody Labeling Kit *Microscale Optimized for Labeling 25 ug Antibody Per Reaction*
1341-AAT 2 Labelings

Buccutite™ Rapid PE-Cy5.5 Tandem Antibody Labeling Kit *Microscale Optimized for Labeling 25 ug Antibody Per Reaction*

Sign In for Pricing
View Details
Isobutyric-d7 Acid
TRC-I789183-250MG 250 mg

Isobutyric-d7 Acid

Sign In for Pricing
View Details
TRIP230 (TRIP11) Rabbit Polyclonal Antibody
TA371578 100 µL

TRIP230 (TRIP11) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details