Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Adenosine receptor A3 (ADORA3)

This Recombinant Sheep Adenosine receptor A3 (ADORA3) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Adenosine receptor A3

UniProt

P35342

Expression Region

1-317

Origin

Ovis aries (Sheep)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVNSTAVSWTSVTYITVEILIGLCAIVGNVLVIWVVKLNPSLQTTTFYFIVSLALADIA VGVLVMPLAIVISLGVTIHFYSCLFMTCLMLIFTHASIMSLLAIAVDRYLRVKLTVRYRR VTTQRRIWLALGLCWLVSFLVGLTPMFGWNMKLSSADENLTFLPCRFRSVMRMDYMVYFS FFLWILVPLVVMCAIYFDIFYIIRNRLSQSFSGSRETGAFYGREFKTAKSLLLVLFLFAL CWLPLSIINCILYFDGQVPQTVLYLGILLSHANSMMNPIVYAYKIKKFKETYLLILKACV MCQPSKSMDPSTEQTSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX7A2L Rabbit Polyclonal Antibody
TA371699 100 µL

COX7A2L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DBF4 (NM_006716) Human Over-expression Lysate
LY402007 100 µg

DBF4 (NM_006716) Human Over-expression Lysate

Sign In for Pricing
View Details
Thymidylate Synthase (TS106 + TMS715), 0.2mg/mL
BNUB0716-100 1x 100 µL

Thymidylate Synthase (TS106 + TMS715), 0.2mg/mL

Sign In for Pricing
View Details
FBP1 Antibody
KC-45710-01 50 μL

FBP1 Antibody

Sign In for Pricing
View Details
FBP1 Antibody
KC-45710-02 100 µL

FBP1 Antibody

Sign In for Pricing
View Details
FBP1 Antibody
KC-45710-03 1 mL

FBP1 Antibody

Sign In for Pricing
View Details