Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Adenosine receptor A3 (ADORA3)

This Recombinant Sheep Adenosine receptor A3 (ADORA3) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Adenosine receptor A3

UniProt

P35342

Expression Region

1-317

Origin

Ovis aries (Sheep)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVNSTAVSWTSVTYITVEILIGLCAIVGNVLVIWVVKLNPSLQTTTFYFIVSLALADIA VGVLVMPLAIVISLGVTIHFYSCLFMTCLMLIFTHASIMSLLAIAVDRYLRVKLTVRYRR VTTQRRIWLALGLCWLVSFLVGLTPMFGWNMKLSSADENLTFLPCRFRSVMRMDYMVYFS FFLWILVPLVVMCAIYFDIFYIIRNRLSQSFSGSRETGAFYGREFKTAKSLLLVLFLFAL CWLPLSIINCILYFDGQVPQTVLYLGILLSHANSMMNPIVYAYKIKKFKETYLLILKACV MCQPSKSMDPSTEQTSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RTL4 activation kit by CRISPRa
GA117493 1 Kit

Human RTL4 activation kit by CRISPRa

Sign In for Pricing
View Details
NUBP1 Human Gene Knockout Kit (CRISPR)
KN417176 1 Kit

NUBP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
COX17 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7H5]
TA812124BM 100 µL

COX17 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7H5]

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS714587 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
MRPS18C Human Gene Knockout Kit (CRISPR)
KN402659 1 Kit

MRPS18C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ADFP (PLIN2) Rabbit Polyclonal Antibody
TA890259 100 µL

ADFP (PLIN2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details