Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Alces alces alces Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Alces alces alces Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

P56442

Expression Region

1-317

Origin

Alces alces alces (European moose) (Elk)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVLGSQRRLLGSLNCTPPATFSLTLAPNRTGPQCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSPMYYFICCLAVSDLLVSVSNVLETAVMLLLEAGALAARAAVVQQLDNVI DVLICGSMVSSLCFLGAIAMDRYISIFYALRYHSVVTLPRAWRIIAAIWVASILTSLLFI TYYNHTVVLLCLVGFFIAMLALMAILYVHMLARACQHARDIARLQKRQHPIHQGFGLKGA ATLTILLGVFFLCWGPFFLHLSLIVLCPQHPTCGCIFKNFNLFLALIICNAIVDPLIYAF RSQELRKTLQEVLQCSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL
BNC400978-100 1x 100 µL

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
BNC471037-500 1x 500 µL

CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/294), CF568 conjugate, 0.1mg/mL
BNC681836-100 1x 100 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/294), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PR484), CF568 conjugate, 0.1mg/mL
BNC680484-100 1x 100 µL

Progesterone Receptor (PR484), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/144B), CF640R conjugate, 0.1mg/mL
BNC400749-100 1x 100 µL

CD8 (C8/144B), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details