Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-26 (srd-26)

This Recombinant Serpentine receptor class delta-26 (srd-26) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-26, Protein srd-26

UniProt

P92015

Expression Region

1-317

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLYQLLHTVLSVTGVTLNAFMMYLALTKSPKIMRPCSAIITIKTFTDILTSAMSFFVMQR IVTDGSSILVIPTGPCTRLGPTACYVGHMFMLCFLECNLIWMISSYIFRYYILYVRDPSI KSLVFVALCLSIPSFIHMAAWIRSYDPNEAFVVPDSFGLASSHLILGGHIVYRSTITLIL QLFITSVLVLIAYAWIRNTLLSFAIKMGSDKNDVKNLNARLVKVINFQVFLPTFIFLGFF IFAAMFGRYITVNIAQYLVSIAFMFSPICSPFSYILFVPHYLNVITGNKKPAENRATDMC AVRAFKNPNVSVTMTNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SH3BP5 Pre-designed siRNA Set B
SI014699B 1 Each

Human SH3BP5 Pre-designed siRNA Set B

Sign In for Pricing
View Details
SENP1 Rabbit Polyclonal Antibody
E53P10956 100 µL

SENP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GULP1 Antibody - N-terminal region : HRP (ARP65446_P050-HRP)
ARP65446_P050-HRP 100 µL

GULP1 Antibody - N-terminal region : HRP (ARP65446_P050-HRP)

Sign In for Pricing
View Details
Human Poliovirus receptor-related protein 2,PVRL2 ELISA KIT
ELI-45481h 96 Tests

Human Poliovirus receptor-related protein 2,PVRL2 ELISA KIT

Sign In for Pricing
View Details
Dolichos biflorus (DBA, Horse gram) (Agarose)
D8085-02 1 mL

Dolichos biflorus (DBA, Horse gram) (Agarose)

Sign In for Pricing
View Details
Kinesin 5B Rabbit Polyclonal Antibody (BF405)
orb2443057 100 µL

Kinesin 5B Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details