Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-26 (srd-26)

This Recombinant Serpentine receptor class delta-26 (srd-26) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-26, Protein srd-26

UniProt

P92015

Expression Region

1-317

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLYQLLHTVLSVTGVTLNAFMMYLALTKSPKIMRPCSAIITIKTFTDILTSAMSFFVMQR IVTDGSSILVIPTGPCTRLGPTACYVGHMFMLCFLECNLIWMISSYIFRYYILYVRDPSI KSLVFVALCLSIPSFIHMAAWIRSYDPNEAFVVPDSFGLASSHLILGGHIVYRSTITLIL QLFITSVLVLIAYAWIRNTLLSFAIKMGSDKNDVKNLNARLVKVINFQVFLPTFIFLGFF IFAAMFGRYITVNIAQYLVSIAFMFSPICSPFSYILFVPHYLNVITGNKKPAENRATDMC AVRAFKNPNVSVTMTNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat (Sprague Dawley) Serum
NRaS Sprague Dawley 1 mL

Rat (Sprague Dawley) Serum

Sign In for Pricing
View Details
IFNA2 Polyclonal Antibody, HRP Conjugated
A53752-050 50 µL

IFNA2 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
C17orf6 Protein Lysate (Human) with C-Ha Tag
13986031 100 µg

C17orf6 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
UBTF (Upstream Binding Transcription Factor, RNA Polymerase I, NOR-90, UBF) (MaxLight 405)
MBS6198576-01 0.1 mL

UBTF (Upstream Binding Transcription Factor, RNA Polymerase I, NOR-90, UBF) (MaxLight 405)

Sign In for Pricing
View Details
UBTF (Upstream Binding Transcription Factor, RNA Polymerase I, NOR-90, UBF) (MaxLight 405)
MBS6198576-02 5x 0.1 mL

UBTF (Upstream Binding Transcription Factor, RNA Polymerase I, NOR-90, UBF) (MaxLight 405)

Sign In for Pricing
View Details
Methyl (3R) -3-amino-4- (benzyloxy) butanoate hydrochloride
CEC82466-01 50 mg

Methyl (3R) -3-amino-4- (benzyloxy) butanoate hydrochloride

Sign In for Pricing
View Details