Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-7 (srd-7)

This Recombinant Serpentine receptor class delta-7 (srd-7) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-7, Protein srd-7

UniProt

Q17760

Expression Region

1-318

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFDISFLFIGINSILTLLGCFINLFLCYLAIFQSPKAIRTYSLVLINITLTNVGACVTGF LLDQRIIQSGKSMLYVSYGYCSLLGEGFCFNIFAAYLHFHTHALWLLFLSFVYRYYVIIR QEPTKKVLQISVVIVYIPSLIQLISMCLQEMNFDELRSLSKEVVPQYNLTGLTITGSLDF FTFAPFYCLVHMAIISFLIAIGIHILRKMIINRMVLNGVDVTIRSRNLHAQLLRTLSFKA TVPIIYYFGCIFFILGRIWINPIFEFSIFVPTVIVPVLTPLSAFIHVAPYRDFVSKMFHG RPKNKTVNSICIIPIISH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(5Beta,6Alpha)-6-Ethyl-3,7-dioxo-cholan-24-oic Acid
TRC-E945815-25MG 25 mg

(5Beta,6Alpha)-6-Ethyl-3,7-dioxo-cholan-24-oic Acid

Sign In for Pricing
View Details
Rat Non Metastatic Cells 1, Protein NM23A Expressed In (NME1) ELISA Kit
RD-NME1-Ra-01 96 Tests

Rat Non Metastatic Cells 1, Protein NM23A Expressed In (NME1) ELISA Kit

Sign In for Pricing
View Details
Rat Non Metastatic Cells 1, Protein NM23A Expressed In (NME1) ELISA Kit
RD-NME1-Ra-02 48 Tests

Rat Non Metastatic Cells 1, Protein NM23A Expressed In (NME1) ELISA Kit

Sign In for Pricing
View Details
CD8B (NM_001178100) Human Over-expression Lysate
LC432674 20 µg

CD8B (NM_001178100) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Sox12 activation kit by CRISPRa
GA204028 1 Kit

Mouse Sox12 activation kit by CRISPRa

Sign In for Pricing
View Details
Cefotiam Dihydrochloride-13C, 15N2
TRC-C243007-5MG 5 mg

Cefotiam Dihydrochloride-13C, 15N2

Sign In for Pricing
View Details