Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-7 (srd-7)

This Recombinant Serpentine receptor class delta-7 (srd-7) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-7, Protein srd-7

UniProt

Q17760

Expression Region

1-318

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFDISFLFIGINSILTLLGCFINLFLCYLAIFQSPKAIRTYSLVLINITLTNVGACVTGF LLDQRIIQSGKSMLYVSYGYCSLLGEGFCFNIFAAYLHFHTHALWLLFLSFVYRYYVIIR QEPTKKVLQISVVIVYIPSLIQLISMCLQEMNFDELRSLSKEVVPQYNLTGLTITGSLDF FTFAPFYCLVHMAIISFLIAIGIHILRKMIINRMVLNGVDVTIRSRNLHAQLLRTLSFKA TVPIIYYFGCIFFILGRIWINPIFEFSIFVPTVIVPVLTPLSAFIHVAPYRDFVSKMFHG RPKNKTVNSICIIPIISH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atg12 Mouse Gene Knockout Kit (CRISPR)
KN501728 1 Kit

Atg12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GMPPA Rabbit Polyclonal Antibody
TA362439 100 µL

GMPPA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Trappc12 Mouse Gene Knockout Kit (CRISPR)
KN518144 1 Kit

Trappc12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human SEPP1 Protein (Fc Tag)
PDMH100337-01 20 µg

Recombinant Human SEPP1 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human SEPP1 Protein (Fc Tag)
PDMH100337-02 100 µg

Recombinant Human SEPP1 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human SEPP1 Protein (Fc Tag)
PDMH100337-03 500 µg

Recombinant Human SEPP1 Protein (Fc Tag)

Sign In for Pricing
View Details