Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus Taste receptor type 2 member 60 (TAS2R60)

This Recombinant Pongo pygmaeus Taste receptor type 2 member 60 (TAS2R60) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 60, T2R60, T2R56

UniProt

Q645U7

Expression Region

1-318

Origin

Pongo pygmaeus (Bornean orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNGDHMVLGSSMTDEKAIILVIILLLLCLVAIAGNCFITAALGMEWVLQRMLLPCDKLLV SLGASRFCPQWVVMGKTTYVFLYPTAFPYNPVLRFLAFQWDLLNAATLWFSTWLSVFYCV KIATFTHPVFLWLKHKLSEWVPWMLFSSVGLSSFTTILFFIGNHRVYQSYLRNHLQPWNV TGNSIWSYCEKFYLFPLKMITWTMPTAVFFICMILLITSLGRHMKKALLTNSGFRDPSVQ AHIKAMLALLSFAMLFISYFLSLVFSAAGIFPPLDFKFWVWESVIYLCAAVHPIILLFSN RRLRAVLKRCRSSRCGTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL
BNC470151-100 1x 100 µL

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL
BNC400679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF647 conjugate, 0.1mg/mL
BNC470338-100 1x 100 µL

P53 (PAb122), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL
BNC940225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (KRT8/2115), CF568 conjugate, 0.1mg/mL
BNC682115-100 1x 100 µL

Cytokeratin 8 (KRT8) (KRT8/2115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details