Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2A2 (OR2A2)

This Recombinant Human Olfactory receptor 2A2 (OR2A2) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Olfactory receptor 2A2, Olfactory receptor 2A17, Olfactory receptor OR7-11

UniProt

Q6IF42

Expression Region

1-318

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGNQTWITDITLLGFQVGPALAILLCGLFSVFYTLTLLGNGVIFGIICLDSKLHTPMYF FLSHLAIIDMSYASNNVPKMLANLMNQKRTISFVPCIMQTFLYLAFAVTECLILVVMSYD RYVAICHPFQYTVIMSWRVCTILVLTSWSCGFALSLVHEILLLRLPFCGPRDVNHLFCEI LSVLKLACADTWVNQVVIFATCVFVLVGPLSLILVSYMHILGAILKIQTKEGRIKAFSTC SSHLCVVGLFFGIAMVVYMVPDSNQREEQEKMLSLFHSVFNPMLNPLIYSLRNAQLKGAL HRALQRKRSMRTVYGLCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine anti-G Antigen 7 antibody ELISA Kit
MBS7277724-01 48 Well

Canine anti-G Antigen 7 antibody ELISA Kit

Sign In for Pricing
View Details
Canine anti-G Antigen 7 antibody ELISA Kit
MBS7277724-02 96 Well

Canine anti-G Antigen 7 antibody ELISA Kit

Sign In for Pricing
View Details
Canine anti-G Antigen 7 antibody ELISA Kit
MBS7277724-03 5x 96 Well

Canine anti-G Antigen 7 antibody ELISA Kit

Sign In for Pricing
View Details
Canine anti-G Antigen 7 antibody ELISA Kit
MBS7277724-04 10x 96 Well

Canine anti-G Antigen 7 antibody ELISA Kit

Sign In for Pricing
View Details
ETK (Phospho-Tyr566) Polyclonal Conjugated Antibody
orb1630666 100 µL

ETK (Phospho-Tyr566) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
PDGFRA discontinued
381400 200 µL

PDGFRA discontinued

Sign In for Pricing
View Details