Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2A2 (OR2A2)

This Recombinant Human Olfactory receptor 2A2 (OR2A2) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Olfactory receptor 2A2, Olfactory receptor 2A17, Olfactory receptor OR7-11

UniProt

Q6IF42

Expression Region

1-318

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEGNQTWITDITLLGFQVGPALAILLCGLFSVFYTLTLLGNGVIFGIICLDSKLHTPMYF FLSHLAIIDMSYASNNVPKMLANLMNQKRTISFVPCIMQTFLYLAFAVTECLILVVMSYD RYVAICHPFQYTVIMSWRVCTILVLTSWSCGFALSLVHEILLLRLPFCGPRDVNHLFCEI LSVLKLACADTWVNQVVIFATCVFVLVGPLSLILVSYMHILGAILKIQTKEGRIKAFSTC SSHLCVVGLFFGIAMVVYMVPDSNQREEQEKMLSLFHSVFNPMLNPLIYSLRNAQLKGAL HRALQRKRSMRTVYGLCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cmtm2a 3'UTR Luciferase Stable Cell Line
TU202523 1.0 mL

Cmtm2a 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
N- (But-3-yn-1-yl) methanesulfonamide
HYB84015-01 50 mg

N- (But-3-yn-1-yl) methanesulfonamide

Sign In for Pricing
View Details
N- (But-3-yn-1-yl) methanesulfonamide
HYB84015-02 0.5 g

N- (But-3-yn-1-yl) methanesulfonamide

Sign In for Pricing
View Details
2- (4-Chlorophenyl) ethylboronic acid pinacol ester
413722-01 100 mg

2- (4-Chlorophenyl) ethylboronic acid pinacol ester

Sign In for Pricing
View Details
2- (4-Chlorophenyl) ethylboronic acid pinacol ester
413722-02 250 mg

2- (4-Chlorophenyl) ethylboronic acid pinacol ester

Sign In for Pricing
View Details
ZFHX1B (Zinc Finger E-Box Binding HomeoBox 2, KIAA0569, SIP-1, SIP1, SMADIP1, ZFHX1B) (MaxLight 750) discontinued
253585-ML750 100 µL

ZFHX1B (Zinc Finger E-Box Binding HomeoBox 2, KIAA0569, SIP-1, SIP1, SMADIP1, ZFHX1B) (MaxLight 750) discontinued

Sign In for Pricing
View Details