Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Leontopithecus rosalia Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Leontopithecus rosalia Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864I3

Expression Region

1-318

Origin

Leontopithecus rosalia (Golden lion tamarin)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPMQGAQRKLLGSLNSTPTATSNLGLAANRTGAPCLELPIPNGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYCFICCLALSDLLVSGSNMLETAVILLLEAGVLATRASVVQQLHNTI DVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAVAAIWVASVLSSTLFI TYYDHAAVLLCLMVFFLAMLVLMAVLYVHMLARARQHAQGIIRLHKRQPPAHKGFGLRGA ATLTILLGIFFLCWGPFFLCLTLVVFCPQHLTCNCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRMLKEVLGRGRW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peroxiredoxin-1 / PRDX1 (1-199, His-tag) Human Protein
AR09077PU-L 500 µg

Peroxiredoxin-1 / PRDX1 (1-199, His-tag) Human Protein

Sign In for Pricing
View Details
ZBTB6 Antibody
6125-01mg 0.1 mg

ZBTB6 Antibody

Sign In for Pricing
View Details
BD 1008 Free Base
T70809-01 25 mg

BD 1008 Free Base

Sign In for Pricing
View Details
BD 1008 Free Base
T70809-02 50 mg

BD 1008 Free Base

Sign In for Pricing
View Details
BD 1008 Free Base
T70809-03 100 mg

BD 1008 Free Base

Sign In for Pricing
View Details
Pipette tips, 100-1000 uL, Racked, Blue, DNase/RNase free - 10 x 96 un. - ABDOS
P10109 10x 96 Units/Pack

Pipette tips, 100-1000 uL, Racked, Blue, DNase/RNase free - 10 x 96 un. - ABDOS

Sign In for Pricing
View Details