Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Leontopithecus rosalia Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Leontopithecus rosalia Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864I3

Expression Region

1-318

Origin

Leontopithecus rosalia (Golden lion tamarin)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPMQGAQRKLLGSLNSTPTATSNLGLAANRTGAPCLELPIPNGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYCFICCLALSDLLVSGSNMLETAVILLLEAGVLATRASVVQQLHNTI DVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAVAAIWVASVLSSTLFI TYYDHAAVLLCLMVFFLAMLVLMAVLYVHMLARARQHAQGIIRLHKRQPPAHKGFGLRGA ATLTILLGIFFLCWGPFFLCLTLVVFCPQHLTCNCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRMLKEVLGRGRW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Mtdh shRNA (UAS) - Lentiviral mouse Mtdh shRNA (UAS, iRFP) plasmid
GTR15306247 1 Vial

Lentiviral mouse Mtdh shRNA (UAS) - Lentiviral mouse Mtdh shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Signal Transducer And Activator of Transcription 1 Phospho-Ser727 (STAT1 pS727) Antibody
abx000500-01 20 µL

Signal Transducer And Activator of Transcription 1 Phospho-Ser727 (STAT1 pS727) Antibody

Sign In for Pricing
View Details
Signal Transducer And Activator of Transcription 1 Phospho-Ser727 (STAT1 pS727) Antibody
abx000500-02 100 µL

Signal Transducer And Activator of Transcription 1 Phospho-Ser727 (STAT1 pS727) Antibody

Sign In for Pricing
View Details
Signal Transducer And Activator of Transcription 1 Phospho-Ser727 (STAT1 pS727) Antibody
abx000500-03 2x 100 µL

Signal Transducer And Activator of Transcription 1 Phospho-Ser727 (STAT1 pS727) Antibody

Sign In for Pricing
View Details
OTTMUSG00000010130 shRNA (m) Lentiviral Particles
sc-151580-V 200 µL

OTTMUSG00000010130 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Mouse Sirtuin 6 (SIRT6) ELISA Kit-Sandwich
EK6F423-01 48 Test

Mouse Sirtuin 6 (SIRT6) ELISA Kit-Sandwich

Sign In for Pricing
View Details