Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Leontopithecus chrysopygus Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Leontopithecus chrysopygus Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864I2

Expression Region

1-318

Origin

Leontopithecus chrysopygus (Gold-and-black lion tamarin)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPMQGAQRKLLGSLNSTPTATSNLGLAANRTGAPCLELPIPNGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYCFICCLALSDLLVSGSNMLETAVILLLEAGVLATRASVVQQLHNTI DVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAVAAIWVASVLSSTLFI TYYDHAAVLLCLMVFFLAMLVLMAVLYVHMLARARQHAQGIIRLHKRQPPAHKGFGLRGA ATLTILLGIFFLCWGPFFLCLTLVVFCPQHLTCNCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRMLKEVLGRGRW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Hydroxybenzyl Isothiocyanate
TRC-H829680-500MG 500 mg

4-Hydroxybenzyl Isothiocyanate

Sign In for Pricing
View Details
Ubxn11 Mouse Gene Knockout Kit (CRISPR)
KN518630 1 Kit

Ubxn11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P27 / KIP1 (KIP1/769), CF568 conjugate, 0.1mg/mL
BNC680769-100 1x 100 µL

P27 / KIP1 (KIP1/769), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human E-Cadherin Recombinant Rabbit Monoclonal Antibody [SY0287] - BSA and Azide free (Detector)
HA723056 100 µL

Human E-Cadherin Recombinant Rabbit Monoclonal Antibody [SY0287] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
AB Pinaca 5-Pentanoic Acid
TRC-A109010-10MG 10 mg

AB Pinaca 5-Pentanoic Acid

Sign In for Pricing
View Details
MAP2K2 Mouse Monoclonal Antibody [Clone ID: 19G10.F1.E2]
TA396787 100 µg

MAP2K2 Mouse Monoclonal Antibody [Clone ID: 19G10.F1.E2]

Sign In for Pricing
View Details