Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Leontopithecus chrysopygus Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Leontopithecus chrysopygus Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864I2

Expression Region

1-318

Origin

Leontopithecus chrysopygus (Gold-and-black lion tamarin)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPMQGAQRKLLGSLNSTPTATSNLGLAANRTGAPCLELPIPNGLFLSLGLVSLVENVLVV AAIAKNRNLHSSMYCFICCLALSDLLVSGSNMLETAVILLLEAGVLATRASVVQQLHNTI DVLTCSSMLCSLCFLGAIAVDRYISIFYALRYHSIMTLPRAQRAVAAIWVASVLSSTLFI TYYDHAAVLLCLMVFFLAMLVLMAVLYVHMLARARQHAQGIIRLHKRQPPAHKGFGLRGA ATLTILLGIFFLCWGPFFLCLTLVVFCPQHLTCNCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRMLKEVLGRGRW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CD32B Monoclonal Antibody
AN301474L-01 50 µL

Recombinant CD32B Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant CD32B Monoclonal Antibody
AN301474L-02 100 µL

Recombinant CD32B Monoclonal Antibody

Sign In for Pricing
View Details
Polystyrene C4 FMP
HB04508008.100G 100 g

Polystyrene C4 FMP

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung: right upper lobe
CS713625 5x 5 µm

Tissue FFPE Sections, Lung: right upper lobe

Sign In for Pricing
View Details
Cardiac Troponin T (TNNT2) (NM_001001432) Human Over-expression Lysate
LC424351 20 µg

Cardiac Troponin T (TNNT2) (NM_001001432) Human Over-expression Lysate

Sign In for Pricing
View Details
Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), Biotin conjugate, 0.1mg/mL
BNCB2984-500 1x 500 µL

Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details