Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 56A1 (OR56A1)

This Recombinant Human Olfactory receptor 56A1 (OR56A1) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Olfactory receptor 56A1, Olfactory receptor OR11-75

UniProt

Q8NGH5

Expression Region

1-318

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQPMASPSNSSTVPVSEFLLICFPNFQSWQHWLSLPLSLLFLLAMGANTTLLITIQLEA SLHQPLYYLLSLLSLLDIVLCLTVIPKVLAIFWYDLRSISFPACFLQMFIMNSFLPMESC TFMVMAYDRYVAICHPLRYPSIITNQFVAKASVFIVVRNALLTAPIPILTSLLHYCGENV IENCICANLSVSRLSCDNFTLNRIYQFVAGWTLLGSDLFLIFLSYTFILRAVLRFKAEGA AVKALSTCGSHFILILFFSTILLVVVLTNVARKKVPMDILILLNVLHHLIPPALNPIVYG VRTKEIKQGIQKLLQRGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VSIG4 Recombinant Rabbit monoclonal Antibody
HA751083 100 µL

VSIG4 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7) (N-term) Rabbit Polyclonal Antibody
AP52419PU-N 400 µL

Cytokeratin 7 (KRT7) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ID4 Antibody
KC-819-01 50 μL

ID4 Antibody

Sign In for Pricing
View Details
ID4 Antibody
KC-819-02 100 µL

ID4 Antibody

Sign In for Pricing
View Details
ID4 Antibody
KC-819-03 1 mL

ID4 Antibody

Sign In for Pricing
View Details
Cytokeratin-19 Antibody (Biotin)
KB-278-01 50 μL

Cytokeratin-19 Antibody (Biotin)

Sign In for Pricing
View Details