Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 56A1 (OR56A1)

This Recombinant Human Olfactory receptor 56A1 (OR56A1) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Olfactory receptor 56A1, Olfactory receptor OR11-75

UniProt

Q8NGH5

Expression Region

1-318

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIQPMASPSNSSTVPVSEFLLICFPNFQSWQHWLSLPLSLLFLLAMGANTTLLITIQLEA SLHQPLYYLLSLLSLLDIVLCLTVIPKVLAIFWYDLRSISFPACFLQMFIMNSFLPMESC TFMVMAYDRYVAICHPLRYPSIITNQFVAKASVFIVVRNALLTAPIPILTSLLHYCGENV IENCICANLSVSRLSCDNFTLNRIYQFVAGWTLLGSDLFLIFLSYTFILRAVLRFKAEGA AVKALSTCGSHFILILFFSTILLVVVLTNVARKKVPMDILILLNVLHHLIPPALNPIVYG VRTKEIKQGIQKLLQRGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CX3CR1 Polyclonal Antibody, Cy3 Conjugated
bs-1728R-Cy3-01 20 µL

CX3CR1 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
CX3CR1 Polyclonal Antibody, Cy3 Conjugated
bs-1728R-Cy3-02 100 µL

CX3CR1 Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
CLSTN2 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-11339R-APC-Cy5.5 100 µL

CLSTN2 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Menin/MEN1 Rabbit Polyclonal Antibody
orb234309 100 µg

Menin/MEN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Avian Estradiol (E2) ELISA Kit
AE64571AV-01 48 Tests

Avian Estradiol (E2) ELISA Kit

Sign In for Pricing
View Details
Avian Estradiol (E2) ELISA Kit
AE64571AV-02 96 Tests

Avian Estradiol (E2) ELISA Kit

Sign In for Pricing
View Details