Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 1030 (Olfr1030)

This Recombinant Mouse Olfactory receptor 1030 (Olfr1030) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Olfactory receptor 1030, Olfactory receptor 196-2

UniProt

Q8VFL5

Expression Region

1-318

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLAPKKMVRGNYSMVTEFILLGLTDRPELQPLLFVLFLVIYLITVGGNLGMMVLIRIDSR LHTPMYYFLASLSCLDLCYSTNVTPKMLVNFLSEKKTISYAACLVQCYFFIAMVITEYYM LAVMAYDRYMAICNPLLYSSKMSKGVCVRLIAGPYIYGFLSGLMETMWTYRLTFCGSNII NHFYCADPPLIRLSCSDTFIKETSMFVVAGFNLSNSLFIILISYLFILIAILRMRSAEGR RKAFSTCGSHLVAVTVFYGTLFCMYVRPPTDKSVEQSKIIAVFYTFVSPMLNPIIYSLRN KDVKHAFWKLVRRNVLSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mcl-1 Monoclonal Antibody
MBS9524980-01 0.05 mL

Mcl-1 Monoclonal Antibody

Sign In for Pricing
View Details
Mcl-1 Monoclonal Antibody
MBS9524980-02 0.1 mL

Mcl-1 Monoclonal Antibody

Sign In for Pricing
View Details
Mcl-1 Monoclonal Antibody
MBS9524980-03 0.2 mL

Mcl-1 Monoclonal Antibody

Sign In for Pricing
View Details
Mcl-1 Monoclonal Antibody
MBS9524980-04 5x 0.2 mL

Mcl-1 Monoclonal Antibody

Sign In for Pricing
View Details
Dengue IgM ELISA
MBS494314-01 96 Tests

Dengue IgM ELISA

Sign In for Pricing
View Details
Dengue IgM ELISA
MBS494314-02 5x 96 Tests

Dengue IgM ELISA

Sign In for Pricing
View Details