Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 13C4 (OR13C4)

This Recombinant Human Olfactory receptor 13C4 (OR13C4) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Olfactory receptor 13C4, Olfactory receptor OR9-7

UniProt

Q8NGS5

Expression Region

1-318

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDKINQTFVREFILLGLSGYPKLEIIFFALILVMYVVILIGNGVLIIASILDSRLHMPMY FFLGNLSFLDICYTTSSIPSTLVSLISKKRNISFSGCAVQMFFGFAMGSTECFLLGMMAF DRYVAICNPLRYPIIMNKVVYVLLTSVSWLSGGINSTVQTSLAMRWPFCGNNIINHFLCE ILAVLKLACSDISVNIVTLAVSNIAFLVLPLLVIFFSYMFILYTILRTNSATGRHKAFST CSAHLTVVIIFYGTIFFMYAKPKSQDLLGKDNLQATEGLVSMFYGVVTPMLNPIIYSLRN KDVKAAIKYLLSRKAINQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-JAB1 Antibody Picoband® (monoclonal, 4G9), HRP Conjugate
M01849-2-HRP 100 µg/Vial

Anti-JAB1 Antibody Picoband® (monoclonal, 4G9), HRP Conjugate

Sign In for Pricing
View Details
GUCY1A3 Antibody
E38PA1519 100 µL

GUCY1A3 Antibody

Sign In for Pricing
View Details
PTMAP8 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV742101 1.0 µg DNA

PTMAP8 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
HMOX1 Recombinant Protein (Human)
RP015016 100 µg

HMOX1 Recombinant Protein (Human)

Sign In for Pricing
View Details
HumanF7 (CoagulationFactorVII) ELISAKit
ELK2238-01 48 Tests

HumanF7 (CoagulationFactorVII) ELISAKit

Sign In for Pricing
View Details
HumanF7 (CoagulationFactorVII) ELISAKit
ELK2238-02 96 Tests

HumanF7 (CoagulationFactorVII) ELISAKit

Sign In for Pricing
View Details