Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 1002 (Olfr1002)

This Recombinant Mouse Olfactory receptor 1002 (Olfr1002) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Olfactory receptor 1002, Olfactory receptor 175-2

UniProt

Q8VFK2

Expression Region

1-318

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMHRNQTVVTEFFFTGLTSSFHLQIVLFLTFLCVYLATLLGNLGMIILIHQDTRLHIPMY FFLSHLSFVDACSSSVISPKMLSDIFVDKKVISFLGCAIQFCLFSQFVVTECFLLASMAY DRYVAICKPLLYTLIMSQRVCVQLVIGPYSIGLISTVVHTTSAFILPYCGPNLINHFFCD LLPVLSLACADTQMNKHLLFIMAGILGVFSGIIILVSYVYIAITILKINSADGRRKAFST CSSHLTAVSILYGTLFFIYVRPSSSFSLDINKVVSLFYTAVIPMLNPFIYSLRNKEVKDA LIRTFEKKFCYSLQDKIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-AXL Antibody (2U890)
TMAB-02986-01 25 µL

Anti-AXL Antibody (2U890)

Sign In for Pricing
View Details
Anti-AXL Antibody (2U890)
TMAB-02986-02 50 μL

Anti-AXL Antibody (2U890)

Sign In for Pricing
View Details
Anti-AXL Antibody (2U890)
TMAB-02986-03 100 µL

Anti-AXL Antibody (2U890)

Sign In for Pricing
View Details
Mouse GAD65 Ready-To-Use IHC Kit
IHC0528M 50 Tests

Mouse GAD65 Ready-To-Use IHC Kit

Sign In for Pricing
View Details
Utf1-set siRNA/shRNA/RNAi Lentivector (Rat)
49387096 4x 500 ng

Utf1-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
EPHB1/2/3 Antibody
E11-15651C 100 µg

EPHB1/2/3 Antibody

Sign In for Pricing
View Details