Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 1002 (Olfr1002)

This Recombinant Mouse Olfactory receptor 1002 (Olfr1002) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Olfactory receptor 1002, Olfactory receptor 175-2

UniProt

Q8VFK2

Expression Region

1-318

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMHRNQTVVTEFFFTGLTSSFHLQIVLFLTFLCVYLATLLGNLGMIILIHQDTRLHIPMY FFLSHLSFVDACSSSVISPKMLSDIFVDKKVISFLGCAIQFCLFSQFVVTECFLLASMAY DRYVAICKPLLYTLIMSQRVCVQLVIGPYSIGLISTVVHTTSAFILPYCGPNLINHFFCD LLPVLSLACADTQMNKHLLFIMAGILGVFSGIIILVSYVYIAITILKINSADGRRKAFST CSSHLTAVSILYGTLFFIYVRPSSSFSLDINKVVSLFYTAVIPMLNPFIYSLRNKEVKDA LIRTFEKKFCYSLQDKIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL2BP Antibody (Biotin)
orb687307-01 50 μL

ARL2BP Antibody (Biotin)

Sign In for Pricing
View Details
ARL2BP Antibody (Biotin)
orb687307-02 100 µL

ARL2BP Antibody (Biotin)

Sign In for Pricing
View Details
BC 11 hydrobromide 5mg
A15325-5 5 mg

BC 11 hydrobromide 5mg

Sign In for Pricing
View Details
Livin/BIRC7 Rabbit Polyclonal Antibody (FITC)
orb2620354 100 µg

Livin/BIRC7 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
ABCA7 Protein Vector (Mouse) (pPM-C-HA)
11022024 500 ng

ABCA7 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
RGS6 CytoSection
TS411189P5 25 Slides

RGS6 CytoSection

Sign In for Pricing
View Details