Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4D5 (OR4D5)

This Recombinant Human Olfactory receptor 4D5 (OR4D5) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Olfactory receptor 4D5, Olfactory receptor OR11-276

UniProt

Q8NGN0

Expression Region

1-318

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPANHSQVAGFVLLGLSQVWELRFVFFTVFSAVYFMTVVGNLLIVVIVTSDPHLHTTMY FLLGNLSFLDFCYSSITAPRMLVDLLSGNPTISFGGCLTQLFFFHFIGGIKIFLLTVMAY DRYIAISQPLHYTLIMNQTVCALLMAASWVGGFIHSIVQIALTIQLPFCGPDKLDNFYCD VPQLIKLACTDTFVLELLMVSNNGLVTLMCFLVLLGSYTALLVMLRSHSREGRSKALSTC ASHIAVVTLIFVPCIYVYTRPFRTFPMDKAVSVLYTIVTPMLNPAIYTLRNKEVIMAMKK LWRRKKDPIGPLEHRPLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUM1L1 Antibody
58-149 400 µL

MUM1L1 Antibody

Sign In for Pricing
View Details
HAS1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-2946R-BF488-TR 20 µL

HAS1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 UPF0060 membrane protein ynfA (ynfA)
MBS7035238-01 0.02 mg

Recombinant Salmonella enteritidis PT4 UPF0060 membrane protein ynfA (ynfA)

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 UPF0060 membrane protein ynfA (ynfA)
MBS7035238-02 0.1 mg

Recombinant Salmonella enteritidis PT4 UPF0060 membrane protein ynfA (ynfA)

Sign In for Pricing
View Details
Recombinant Salmonella enteritidis PT4 UPF0060 membrane protein ynfA (ynfA)
MBS7035238-03 5x 0.1 mg

Recombinant Salmonella enteritidis PT4 UPF0060 membrane protein ynfA (ynfA)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB622841 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details