Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4D5 (OR4D5)

This Recombinant Human Olfactory receptor 4D5 (OR4D5) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Olfactory receptor 4D5, Olfactory receptor OR11-276

UniProt

Q8NGN0

Expression Region

1-318

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPANHSQVAGFVLLGLSQVWELRFVFFTVFSAVYFMTVVGNLLIVVIVTSDPHLHTTMY FLLGNLSFLDFCYSSITAPRMLVDLLSGNPTISFGGCLTQLFFFHFIGGIKIFLLTVMAY DRYIAISQPLHYTLIMNQTVCALLMAASWVGGFIHSIVQIALTIQLPFCGPDKLDNFYCD VPQLIKLACTDTFVLELLMVSNNGLVTLMCFLVLLGSYTALLVMLRSHSREGRSKALSTC ASHIAVVTLIFVPCIYVYTRPFRTFPMDKAVSVLYTIVTPMLNPAIYTLRNKEVIMAMKK LWRRKKDPIGPLEHRPLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H2A.X
318940-01 50 µg

Histone H2A.X

Sign In for Pricing
View Details
Histone H2A.X
318940-02 100 µg

Histone H2A.X

Sign In for Pricing
View Details
Rabbit Polyclonal Melatonin R1A/MT1/MTNR1A Antibody
NBP3-14400 50 µg

Rabbit Polyclonal Melatonin R1A/MT1/MTNR1A Antibody

Sign In for Pricing
View Details
RNF185 Protein Vector (Mouse) (pPB-C-His)
PV224778 500 ng

RNF185 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Goat ATP binding cassette sub family A member 3 (ABCA3) ELISA kit
GTR10374135 96 Well

Goat ATP binding cassette sub family A member 3 (ABCA3) ELISA kit

Sign In for Pricing
View Details
Rabbit Polyclonal ODR4/TTG1 Antibody [DyLight 405]
NBP2-98046V 0.1 mL

Rabbit Polyclonal ODR4/TTG1 Antibody [DyLight 405]

Sign In for Pricing
View Details