Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4D5 (OR4D5)

This Recombinant Human Olfactory receptor 4D5 (OR4D5) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Olfactory receptor 4D5, Olfactory receptor OR11-276

UniProt

Q8NGN0

Expression Region

1-318

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNPANHSQVAGFVLLGLSQVWELRFVFFTVFSAVYFMTVVGNLLIVVIVTSDPHLHTTMY FLLGNLSFLDFCYSSITAPRMLVDLLSGNPTISFGGCLTQLFFFHFIGGIKIFLLTVMAY DRYIAISQPLHYTLIMNQTVCALLMAASWVGGFIHSIVQIALTIQLPFCGPDKLDNFYCD VPQLIKLACTDTFVLELLMVSNNGLVTLMCFLVLLGSYTALLVMLRSHSREGRSKALSTC ASHIAVVTLIFVPCIYVYTRPFRTFPMDKAVSVLYTIVTPMLNPAIYTLRNKEVIMAMKK LWRRKKDPIGPLEHRPLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB2B Antibody
orb194869-01 50 μL

RAB2B Antibody

Sign In for Pricing
View Details
RAB2B Antibody
orb194869-02 100 µL

RAB2B Antibody

Sign In for Pricing
View Details
Single Adj Trolley 850mm Set 01 Silver with Lime Trays - EACH
SED1072AD 1 Each

Single Adj Trolley 850mm Set 01 Silver with Lime Trays - EACH

Sign In for Pricing
View Details
Olfr750 siRNA (m)
sc-151108 10 µM

Olfr750 siRNA (m)

Sign In for Pricing
View Details
Recombinant Mycobacterium vanbaalenii Nucleoside diphosphate kinase (ndk)
MBS1250883-01 0.02 mg (E-Coli)

Recombinant Mycobacterium vanbaalenii Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details
Recombinant Mycobacterium vanbaalenii Nucleoside diphosphate kinase (ndk)
MBS1250883-02 0.1 mg (E-Coli)

Recombinant Mycobacterium vanbaalenii Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details