Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 2W6 (OR2W6P)

This Recombinant Human Putative olfactory receptor 2W6 (OR2W6P) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Putative olfactory receptor 2W6, Olfactory receptor OR6-3, Putative olfactory receptor 2W7

UniProt

Q8NHA6

Expression Region

1-318

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGFYHVGQAAFELLTSSFILVGFSDRPHLELIVFVVVLIFYLLTLLGNMTIVLLSALDSR LHTPMYFFLANLSFLDMCFTTGSIPQMLYNLWGPDKTISYVGCAIQLYFVLALGGVECVL LAVMAYDRYAAVCKPLHYTIIMHPRLCGQLASVAWLSGFGNSLIMAPQTLMLPRCGHRRV DHFLCEMPALIGMACVDTMMLEALAFALAIFIILAPLILILISYGYVGGTVLRIKSAAGR KKAFNTCSSHLIVVSLFYGTIIYMYLQPANTYSQDQGKFLTLFYTIVTPSVNPLIYTLRN KDVKEAMKKVLGKGSAEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Factor Related Apoptosis (FAS) ELISA Kit
RD-FAS-Ra-01 96 Tests

Rat Factor Related Apoptosis (FAS) ELISA Kit

Sign In for Pricing
View Details
Rat Factor Related Apoptosis (FAS) ELISA Kit
RD-FAS-Ra-02 48 Tests

Rat Factor Related Apoptosis (FAS) ELISA Kit

Sign In for Pricing
View Details
OR5AP2 Antibody
8G473-AAT 50 µg

OR5AP2 Antibody

Sign In for Pricing
View Details
Calponin-1 (Smooth Muscle Marker) (CNN1/1408R), CF405S conjugate, 0.1mg/mL
BNC041408-500 1x 500 µL

Calponin-1 (Smooth Muscle Marker) (CNN1/1408R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Portable Ultrasonic Processor BLIH-401
BLIH-401 1 Unit

Portable Ultrasonic Processor BLIH-401

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS808765 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details