Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 2W6 (OR2W6P)

This Recombinant Human Putative olfactory receptor 2W6 (OR2W6P) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Putative olfactory receptor 2W6, Olfactory receptor OR6-3, Putative olfactory receptor 2W7

UniProt

Q8NHA6

Expression Region

1-318

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGFYHVGQAAFELLTSSFILVGFSDRPHLELIVFVVVLIFYLLTLLGNMTIVLLSALDSR LHTPMYFFLANLSFLDMCFTTGSIPQMLYNLWGPDKTISYVGCAIQLYFVLALGGVECVL LAVMAYDRYAAVCKPLHYTIIMHPRLCGQLASVAWLSGFGNSLIMAPQTLMLPRCGHRRV DHFLCEMPALIGMACVDTMMLEALAFALAIFIILAPLILILISYGYVGGTVLRIKSAAGR KKAFNTCSSHLIVVSLFYGTIIYMYLQPANTYSQDQGKFLTLFYTIVTPSVNPLIYTLRN KDVKEAMKKVLGKGSAEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Metrizoic Acid
TRC-M338935-2G 2 g

Metrizoic Acid

Sign In for Pricing
View Details
Rapgef4 Antibody
KC-2510-01 50 μL

Rapgef4 Antibody

Sign In for Pricing
View Details
Rapgef4 Antibody
KC-2510-02 100 µL

Rapgef4 Antibody

Sign In for Pricing
View Details
Rapgef4 Antibody
KC-2510-03 1 mL

Rapgef4 Antibody

Sign In for Pricing
View Details
1H-1,2,3-Triazole-1-acetic Acid
TRC-T767545-50MG 50 mg

1H-1,2,3-Triazole-1-acetic Acid

Sign In for Pricing
View Details
4-Benzoquinone Monoxime
TRC-B206610-500MG 500 mg

4-Benzoquinone Monoxime

Sign In for Pricing
View Details