Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 154 (Olfr154)

This Recombinant Mouse Olfactory receptor 154 (Olfr154) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Olfactory receptor 154, Olfactory receptor 175-1

UniProt

Q9QY00

Expression Region

1-318

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMHRNQTVVTEFFFTGLTSSFHLQIVLFLTFLCVYLATLLGNLGMIILIHLDTRLHIPMY FFLSHLSFVDACSSSVISPKMLSDMFVDKKVISFLGCAIQLCLFSQFVVTECFLLASMAY DRYVAICKPLLYTLIMSQRVCVQLVIGPYSIGFVSTMVHIISAFVLPYCGPNLINHFFCD LLPVLSLACANTQMKKRLLFIVAGILGVFSGIIILVSYVYIAITILKISSADGRRKAFST CSSHLTAVSILYGTLFFIYVRPSSSFSLDINKVVSLFYTTVIPMLNPFIYSLRNKEVKDA LIRTFEKQFCYSFQDKIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Omd siRNA Oligos set (Rat)
34814176 3x 5 nmol

Omd siRNA Oligos set (Rat)

Sign In for Pricing
View Details
WISP3 ELISA Kit (Human) (OKEH04333)
OKEH04333 96 Well

WISP3 ELISA Kit (Human) (OKEH04333)

Sign In for Pricing
View Details
Anti-CD122/IL2RB Antibody (R3D71)
RHD06902 100 μg

Anti-CD122/IL2RB Antibody (R3D71)

Sign In for Pricing
View Details
DMTr-2'-F-dG (iBu) -3'-PS2-Amidite
PA304-10 10 g

DMTr-2'-F-dG (iBu) -3'-PS2-Amidite

Sign In for Pricing
View Details
APC/Cy7 Linked Polyclonal Antibody to Calprotectin (CALPRO)
MBS2110737-01 1 mL

APC/Cy7 Linked Polyclonal Antibody to Calprotectin (CALPRO)

Sign In for Pricing
View Details
APC/Cy7 Linked Polyclonal Antibody to Calprotectin (CALPRO)
MBS2110737-02 5 mL

APC/Cy7 Linked Polyclonal Antibody to Calprotectin (CALPRO)

Sign In for Pricing
View Details