Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Olfactory receptor-like protein COR3 (COR3)

This Recombinant Chicken Olfactory receptor-like protein COR3 (COR3) spans the amino acid sequence from region 1-318.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein COR3

UniProt

P37069

Expression Region

1-318

Origin

Gallus gallus (Chicken)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASGNCTTPTTFILSGLTDNPGLQMPLFMVFLAIYTITLLTNLGLIRLISVDLHLQTPMY IFLQNLSFTDAAYSTVITPKMLATFLEERKTISYVGCILQYFSFVLLTTSECLLLAVMAY DRYVAICKPLLYPAIMTKAVCWRLVESLYFLAFLNSLVHTCGLLKLSFCYSNVVNHFFCD ISPLFQISSSSIAISELLVIISGSLFVMSSIIIILISYVFIILTVVMIRSKDGKYKAFST CTSHLMAVSLFHGTVIFMYLRPVKLFSLDTDKIASLFYTVVIPMLNPLIYSWRNKEVKDA LRRLTATTFGFIDSKAVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DAOA activation kit by CRISPRa
GA116956 1 Kit

Human DAOA activation kit by CRISPRa

Sign In for Pricing
View Details
Sulfo-Cyanine 3 carboxylic acid
260-AAT 25 mg

Sulfo-Cyanine 3 carboxylic acid

Sign In for Pricing
View Details
AMBP Antibody
KC-380-01 50 μL

AMBP Antibody

Sign In for Pricing
View Details
AMBP Antibody
KC-380-02 100 µL

AMBP Antibody

Sign In for Pricing
View Details
AMBP Antibody
KC-380-03 1 mL

AMBP Antibody

Sign In for Pricing
View Details
PPP1CA Antibody
KC-6450-01 50 μL

PPP1CA Antibody

Sign In for Pricing
View Details