Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Corynebacterium glutamicum Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Corynebacterium glutamicum Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

A4QFF5

Expression Region

1-319

Origin

Corynebacterium glutamicum (strain R)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDVMTLATIPSPPQGVWYLGPIPIRAYAMCIIAGIIVAIWLTRKRYAARGGNPEIVLDAA IVAVPAGIIGGRIYHVITDNQKYFCDTCNPVDAFKITNGGLGIWGAVILGGLAVAVFFRY KKLPLAPFADAVAPAVILAQGIGRLGNWFNQELYGAETTVPWALEIYYRVDENGKFAPVT GTSTGEVMATVHPTFLYELLWNLLIFALLMWADKRFKLGHGRVFALYVAGYTLGRFWIEQ MRVDEATLIGGIRINTIVSAVVFAGAIIVFFLLKKGRETPEEVDPTFAASVAADAVASPD GKPLPKAGEGIDGETPSTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (MLANA/788), CF594 conjugate, 0.1mg/mL
BNC940788-500 1x 500 µL

MART-1 / Melan-A (MLANA/788), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Involucrin (SY5), CF740 conjugate, 0.1mg/mL
BNC740678-500 1x 500 µL

Involucrin (SY5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/418), CF488A conjugate, 0.1mg/mL
BNC880418-500 1x 500 µL

Fascin-1 (FSCN1/418), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
BNC680225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), CF647 conjugate, 0.1mg/mL
BNC471970-500 1x 500 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF405S conjugate, 0.1mg/mL
BNC042052-500 1x 500 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/2052R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details