Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Free fatty acid receptor 3 (Ffar3)

This Recombinant Mouse Free fatty acid receptor 3 (Ffar3) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Free fatty acid receptor 3, G-protein coupled receptor 41

UniProt

Q3UFD7

Expression Region

1-319

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTSFFLGNYWLFFSVYLLVFLVGLPLNVMALVVFVGKLRRRPVAVDLLLLNLTISDLLL LLFLPFRMVEAACGMRWLLPFIFCPLSGFLFFTTIYLTSLFLTAVSIERFLSVAYPLWYK TRPRLAQAGLVSVVCWFLASAHCSVVYITEYWGNATYSQGTNGTCYLEFREDQLAILLPV RLEMAVVLFMVPLCITSYCYSRLVWILSRGASRRRRKRIMGLLAATLLIFFVCFGPYNMS HVVGYVSRESPSWRSYVLLLSTLNSCIDPLVFYFSSSKFQADFHQLLGRLLRTCVPWTQQ VSLELKVKNGEEPSKECPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL
BNC940226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-100 1x 100 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF647 conjugate, 0.1mg/mL
BNC470333-100 1x 100 µL

CD8 (RIV11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF647 conjugate, 0.1mg/mL
BNC470871-500 1x 500 µL

CD71 (66IG10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
BNC051037-100 1x 100 µL

CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details