Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 7A5 (OR7A5)

This Recombinant Human Olfactory receptor 7A5 (OR7A5) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Olfactory receptor 7A5, Olfactory receptor OR19-17, Olfactory receptor TPCR92

UniProt

Q15622

Expression Region

1-319

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPGNDTQISEFLLLGFSQEPGLQPFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMY FFLSNLSFADICVTSTTIPKMLMNIQTQNKVITYIACLMQMYFFILFAGFENFLLSVMAY DRFVAICHPLHYMVIMNPHLCGLLVLASWTMSALYSLLQILMVVRLSFCTALEIPHFFCE LNQVIQLACSDSFLNHMVIYFTVALLGGGPLTGILYSYSKIISSIHAISSAQGKYKAFST CASHLSVVSLFYGAILGVYLSSAATRNSHSSATASVMYTVVTPMLNPFIYSLRNKDIKRA LGIHLLWGTMKGQFFKKCP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VC Lambda / EcoR I Marker (ready-to-use), 50µg
NM2403 50 µg

VC Lambda / EcoR I Marker (ready-to-use), 50µg

Sign In for Pricing
View Details
AMDHD1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B5]
TA809949AM 100 µL

AMDHD1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B5]

Sign In for Pricing
View Details
Recombinant VAMP2 Antibody
RC-6419-01 50 μL

Recombinant VAMP2 Antibody

Sign In for Pricing
View Details
Recombinant VAMP2 Antibody
RC-6419-02 100 µL

Recombinant VAMP2 Antibody

Sign In for Pricing
View Details
Recombinant VAMP2 Antibody
RC-6419-03 1 mL

Recombinant VAMP2 Antibody

Sign In for Pricing
View Details
Slc25a29 Mouse Gene Knockout Kit (CRISPR)
KN515975 1 Kit

Slc25a29 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details