Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 7A5 (OR7A5)

This Recombinant Human Olfactory receptor 7A5 (OR7A5) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Olfactory receptor 7A5, Olfactory receptor OR19-17, Olfactory receptor TPCR92

UniProt

Q15622

Expression Region

1-319

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPGNDTQISEFLLLGFSQEPGLQPFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMY FFLSNLSFADICVTSTTIPKMLMNIQTQNKVITYIACLMQMYFFILFAGFENFLLSVMAY DRFVAICHPLHYMVIMNPHLCGLLVLASWTMSALYSLLQILMVVRLSFCTALEIPHFFCE LNQVIQLACSDSFLNHMVIYFTVALLGGGPLTGILYSYSKIISSIHAISSAQGKYKAFST CASHLSVVSLFYGAILGVYLSSAATRNSHSSATASVMYTVVTPMLNPFIYSLRNKDIKRA LGIHLLWGTMKGQFFKKCP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEY2 Antibody
8C11818-AAT 50 µg

HEY2 Antibody

Sign In for Pricing
View Details
Double Strand Breaks (DSB) Repair Antibody Sampler Kit
HAK21108 1 Kit

Double Strand Breaks (DSB) Repair Antibody Sampler Kit

Sign In for Pricing
View Details
Recombinant Rat CD86/B7-2 Protein (His Tag)
PKSR030396 100 µg

Recombinant Rat CD86/B7-2 Protein (His Tag)

Sign In for Pricing
View Details
ESE1 (ELF3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G5]
TA809988AM 100 µL

ESE1 (ELF3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G5]

Sign In for Pricing
View Details
Trp53 Mouse Gene Knockout Kit (CRISPR)
KN318278RB 1 Kit

Trp53 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Rat TNFR1/TNFRSF1A Protein (Fc Tag)
PKSR030339 100 µg

Recombinant Rat TNFR1/TNFRSF1A Protein (Fc Tag)

Sign In for Pricing
View Details