Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Vomeronasal type-1 receptor B14 (V1rb14)

This Recombinant Rat Vomeronasal type-1 receptor B14 (V1rb14) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Vomeronasal type-1 receptor B14

UniProt

Q5J3L4

Expression Region

1-319

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKVNILPSDTNIKITLFSEVSVGISANSVLFFAHLCMFFEENRSKPIDLCIAFLSLTQL MLLVTMGLIAADMFMSQGIWDSTTCRSIIYFHRLLRGFNLCAACLLHILWTFTLSPRSSC LTKFKHKSPHHISCAFFSLCVLYMLFSSHLFVLIIATSNLTSDHFMYVTQSCSILPMSYS RTTMFSLVMVTREAFLISLMALFSGYMVTLLWRHKKQVQHLHSTSLSSKSSPQQRATRTI LLLMSFFVVLYILDIVIFQSRTKFKDGSMFYSLHIIVSHSYATISPFVFIFSDKRIIKFL GSMSGRIINICLFSDGYGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF660R conjugate, 0.1mg/mL
BNC610164-100 1x 100 µL

CD28 (204.12), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF405S conjugate, 0.1mg/mL
BNC040305-500 1x 500 µL

CD95 (B-R18), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
BNC470352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
BNC040043-100 1x 100 µL

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
BNC042853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
BNC040352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details