Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Taste receptor type 2 member 14 (TAS2R14)

This Recombinant Macaca mulatta Taste receptor type 2 member 14 (TAS2R14) spans the amino acid sequence from region 1-319.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 14, T2R14

UniProt

Q645T2

Expression Region

1-319

Origin

Macaca mulatta (Rhesus macaque)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGVIKSIFTFILIVEFIIGNLGNSFIVLVNCIDWVKRRKISLVDQILIALAISRISLVW SIFGSWCVSVFFPALFATEKLLRMLTNIWTVTNHFSVWLATILGTFYFLKIANFSNSIFL YLKWRVKKVVLVLLLVTLGLLFLNILLINIHINASINGYRGNMTCSSASCNFIRFSRAIA LTSTVFVLIPFTLSLATSLLLSFSLWKHHKKMQHTVKGYRDVSTKAHRGVMQTVITFLLL YAVFLLTFFISIWASVRLKENQIIILSEMMGLAYPSGHSCVLILGNKKLRQASLSVLWWL RYRFKHGEPSGHKEFRESS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL
BNC740270-100 1x 100 µL

Fibronectin (HFN7.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-500 1x 500 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF568 conjugate, 0.1mg/mL
BNC680449-100 1x 100 µL

CD104 (UM-A9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF740 conjugate, 0.1mg/mL
BNC741388-100 1x 100 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a (O10), CF568 conjugate, 0.1mg/mL
BNC680667-500 1x 500 µL

CD1a (O10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details