Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Papio hamadryas Taste receptor type 2 member 46 (TAS2R46)

This Recombinant Papio hamadryas Taste receptor type 2 member 46 (TAS2R46) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 46, T2R46

UniProt

Q646G0

Expression Region

1-309

Origin

Papio hamadryas (Hamadryas baboon)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MITFLPITFSILIVVIFFIGNFANGFIALINSIEWVKRQKISFAGQILTALAVSRVGLLW VLSLHWYATEFNLAFHSVEVRSTAYNVWVVTNHFSNWLSTSLSMFYLLRIATFSNLIFLH LNRRVKSVILVTLLGPLLFLVCQLFVMNMNQIVRTKEYEGNMTWKIKLKSAMYLSNTTVA MLANFVPLTLTLISFLLLICSLCKHLKKMRVHGKGSQDPSTKVHTKALQIVTSFLLVCAI YFLSIILSVWNSGGLENKPFFMFCQAIKFSYPSTHPFILIWGNKTLKQTFLSVLRNVRYW VKGQKPSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
BNC051037-100 1x 100 µL

CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
BNC400257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mesothelin (Mesothelial Marker) (MSLN/2131), CF568 conjugate, 0.1mg/mL
BNC682131-100 1x 100 µL

Mesothelin (Mesothelial Marker) (MSLN/2131), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2452), CF647 conjugate, 0.1mg/mL
BNC472452-500 1x 500 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2452), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), CF405S conjugate, 0.1mg/mL
BNC041803-100 1x 100 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/1803), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (HJ21), CF647 conjugate, 0.1mg/mL
BNC470984-100 1x 100 µL

P21 / WAF1 (HJ21), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details