Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Mas-related G-protein coupled receptor member E (Mrgpre)

This Recombinant Rat Mas-related G-protein coupled receptor member E (Mrgpre) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Mas-related G-protein coupled receptor member E

UniProt

Q7TN40

Expression Region

1-309

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLRVHTHSPSTQGDMAFNLTILSLTELLSLGGLLGNGVALWLLNQNVYRNPFSIYLLDV ACADLIFLCCHMVAIIPELLQDQLNFPEFVHISLIMLRFFCYIVGLSLLVAISTEQCLAT LFPSGYLCRRPRYLTTCVCAFIWVLCLLLDLLLSGACTQFFGAPSYHLCGMLWLVVAVLL AALCCTMCVTSLLLLLRVERGPERHQPRGFPTLVLLVILLFLFCGLPFGIFWLSKNLSWH TPLYFYHFSFFMASVHSAAKPAIYFFLGSTPGQRFQEPLRLVLQRALGDEAELGAVREAS QGGLVDMTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-100 1x 100 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-500 1x 500 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF488A conjugate, 0.1mg/mL
BNC880189-100 1x 100 µL

CD74 (BU45), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-100 1x 100 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF568 conjugate, 0.1mg/mL
BNC680287-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (66.4.C2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL
BNC940978-100 1x 100 µL

CD7 (T3-3A1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details