Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Taste receptor type 2 member 113 (Tas2r113)

This Recombinant Mouse Taste receptor type 2 member 113 (Tas2r113) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 113, T2R113, mT2R58

UniProt

Q7M711

Expression Region

1-309

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVAVLQSTLPIIFSMEFIMGTLGNGFIFLIVCIDWVQRRKISLVDQIRTALAISRIALIW LIFLDWWVSVHYPALHETGKMLSTYLISWTVINHCNFWLTANLSILYFLKIANFSNIIFL YLKFRSKNVVLVTLLVSLFFLFLNTVIIKIFSDVCFDSVQRNVSQIFIMYNHEQICKFLS FTNPMFTFIPFVMSTVMFSLLIFSLWRHLKNMQHTAKGCRDISTTVHIRALQTIIVSVVL YTIFFLSFFVKVWSFVSPERYLIFLFVWALGNAVFSAHPFVMILVNRRLRLASLSLIFWL WYRFKNIEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-500 1x 500 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL
BNC880391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
BNC940096-100 1x 100 µL

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (31G7), CF405S conjugate, 0.1mg/mL
BNC041194-500 1x 500 µL

EGFR (31G7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (PTH/1173), CF405S conjugate, 0.1mg/mL
BNC041173-100 1x 100 µL

PTH / Parathyroid Hormone (N-Terminal) (PTH/1173), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details