Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Taste receptor type 2 member 124 (Tas2r124)

This Recombinant Mouse Taste receptor type 2 member 124 (Tas2r124) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 124, T2R124, mT2R50

UniProt

Q7M718

Expression Region

1-309

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVPVLHSLSTIILIAEFVWGNLSNGLIVLKNCIDWINKKELSTVDQILIVLAISRISLIW ETLIIWVKDQLISSITIEELKIIVFSFILSSHFSLWLATALSIFYLFRIPNCYWQIFLYL KWRIKQLIVHMLLGSLVFLVANMIQITITLEERFYQYGGNTSVNSMETEFSILIELMLFN MTMFSIIPFSLALISFLLLIFSLWKHLQKMPLNSRGDRDPSATAHRNALRILVSFLLLYT IYFLSLLISWVAQKNQSELVHIICMITSLVYPSFHSYILILGNYKLKQTSLWVMRQLGCR MKRQNTPTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF405S conjugate, 0.1mg/mL
BNC040151-500 1x 500 µL

CD11a (Cris-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-100 1x 100 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF568 conjugate, 0.1mg/mL
BNC680175-100 1x 100 µL

CD46 (122.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-100 1x 100 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
BNC401045-100 1x 100 µL

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL
BNC400146-100 1x 100 µL

CD10 (CB-CALLA), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details