Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5AK2 (OR5AK2)

This Recombinant Human Olfactory receptor 5AK2 (OR5AK2) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 5AK2

UniProt

Q8NH90

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLGNSTEVTEFYLLGFGAQHEFWCILFIVFLLIYVTSIMGNSGIILLINTDSRFQTLTY FFLQHLAFVDICYTSAITPKMLQSFTEEKNLMLFQGCVIQFLVYATFATSDCYLLAMMAV DPYVAICKPLHYTVIMSRTVCIRLVAGSYIMGSINASVQTGFTCSLSFCKSNSINHFFCD VPPILALSCSNVDINIMLLVVFVGSNLIFTGLVVIFSYIYIMATILKMSSSAGRKKSFST CASHLTAVTIFYGTLSYMYLQSHSNNSQENMKVAFIFYGTVIPMLNPLIYSLRNKEVKEA LKVIGKKLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibroblast Growth Factor-22 Human Recombinant
rAP-2216 1 Each

Fibroblast Growth Factor-22 Human Recombinant

Sign In for Pricing
View Details
Xpress™ Human NUBP2 Over-expressing Stable Cell Line
ABC-X2102 1 Vial

Xpress™ Human NUBP2 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
Bromodeoxyuridine (Brdu)
MM-1006-01 0.5 mL

Bromodeoxyuridine (Brdu)

Sign In for Pricing
View Details
Mouse Ubiquitin (Ub) ELISA Kit
RDR-Ub-Mu-48Tests 48 Tests

Mouse Ubiquitin (Ub) ELISA Kit

Sign In for Pricing
View Details
Human GAS2 activation kit by CRISPRa
GA101741 1 Kit

Human GAS2 activation kit by CRISPRa

Sign In for Pricing
View Details
Histone H3 (Phospho-Thr3) Antibody
MBS9502429-01 0.05 mL

Histone H3 (Phospho-Thr3) Antibody

Sign In for Pricing
View Details