Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5AK2 (OR5AK2)

This Recombinant Human Olfactory receptor 5AK2 (OR5AK2) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 5AK2

UniProt

Q8NH90

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLGNSTEVTEFYLLGFGAQHEFWCILFIVFLLIYVTSIMGNSGIILLINTDSRFQTLTY FFLQHLAFVDICYTSAITPKMLQSFTEEKNLMLFQGCVIQFLVYATFATSDCYLLAMMAV DPYVAICKPLHYTVIMSRTVCIRLVAGSYIMGSINASVQTGFTCSLSFCKSNSINHFFCD VPPILALSCSNVDINIMLLVVFVGSNLIFTGLVVIFSYIYIMATILKMSSSAGRKKSFST CASHLTAVTIFYGTLSYMYLQSHSNNSQENMKVAFIFYGTVIPMLNPLIYSLRNKEVKEA LKVIGKKLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ITGA3 Knockout HEK293T cell line
GTR15422415 1 Vial

Human ITGA3 Knockout HEK293T cell line

Sign In for Pricing
View Details
OR2N1P sgRNA CRISPR Lentivector set (Human)
K1497401 3x 1.0 µg

OR2N1P sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
MYP14 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV735807 1.0 µg DNA

MYP14 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
ICOS Ligand (ICOSLG) (NM_001283052) Human Tagged ORF Clone
RG236647 10 µg

ICOS Ligand (ICOSLG) (NM_001283052) Human Tagged ORF Clone

Sign In for Pricing
View Details
SLC35F4 Lentiviral Activation Particles (m2)
sc-429046-LAC-2 200 µL

SLC35F4 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
IL12A Rabbit Polyclonal Antibody (BF350)
orb1592558 100 µL

IL12A Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details