Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6C4 (OR6C4)

This Recombinant Human Olfactory receptor 6C4 (OR6C4) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 6C4, Olfactory receptor OR12-10

UniProt

Q8NGE1

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNRTMFGEFILLGLTNQPELQVMIFIFLFLTYMLSILGNLTIITLTLLDPHLQTPMYFF LRNFSFLEISFTSIFIPRFLTSMTTGNKVISFAGCLTQYFFAIFLGATEFYLLASMSYDR YVAICKPLHYLTIMSSRVCIQLVFCSWLGGFLAILPPIILMTQVDFCVSNILNHYYCDYG PLVELACSDTSLLELMVILLAVVTLMVTLVLVTLSYTYIIRTILRIPSAQQRTKAFSTCS SHMIVISLSYGSCMFMYINPSAKEGGAFNKGIAVLITSVTPLLNPFIYTLRNQQVKQAFK DSVKKIVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TLN2 Pre-designed siRNA Set B
SI016706B 1 Each

Human TLN2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Ints10 (NM_027590) Mouse Tagged ORF Clone
MR210189 10 µg

Ints10 (NM_027590) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Sodium Hydroxide 6M (6N) Solution
2424I 02500 2.5 L

Sodium Hydroxide 6M (6N) Solution

Sign In for Pricing
View Details
GlycoBind Binding Buffer - TL
21511272-3 100 mL

GlycoBind Binding Buffer - TL

Sign In for Pricing
View Details
Rabbit PCK1 (Phosphoenolpyruvate Carboxykinase 1) ELISA Kit
MBS2503055-01 24 Tests

Rabbit PCK1 (Phosphoenolpyruvate Carboxykinase 1) ELISA Kit

Sign In for Pricing
View Details
Rabbit PCK1 (Phosphoenolpyruvate Carboxykinase 1) ELISA Kit
MBS2503055-02 48 Tests

Rabbit PCK1 (Phosphoenolpyruvate Carboxykinase 1) ELISA Kit

Sign In for Pricing
View Details