Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4B1 (OR4B1)

This Recombinant Human Olfactory receptor 4B1 (OR4B1) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 4B1, OST208, Olfactory receptor OR11-106

UniProt

Q8NGF8

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASTSNVTELIFTGLFQDPAVQSVCFVVFLPVYLATVVGNGLIVLTVSISKSLDSPMYFF LSCLSLVEISYSSTIAPKFIIDLLAKIKTISLEGCLTQIFFFHFFGVAEILLIVVMAYDC YVAICKPLHYMNIISRQLCHLLVAGSWLGGFCHSIIQILVIIQLPFCGPNVIDHYFCDLQ PLFKLACTDTFMEGVIVLANSGLFSVFSFLILVSSYIVILVNLRNHSAEGRHKALSTCAS HITVVILFFGPAIFLYMRPSSTFTEDKLVAVFYTVITPMLNPIIYTLRNAEVKIAIRRLW SKKENPGRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR4F2P 3'UTR Lenti-reporter-Luc Vector
35215081 1.0 µg

OR4F2P 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
MYL2 (Myosin Regulatory Light Chain 2, Ventricular/Cardiac Muscle Isoform, MLC-2, MLC-2v, DKFZp779C0562) (MaxLight 490) discontinued
138168-ML490 100 µL

MYL2 (Myosin Regulatory Light Chain 2, Ventricular/Cardiac Muscle Isoform, MLC-2, MLC-2v, DKFZp779C0562) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Recombinant Human Eukaryotic translation initiation factor 2-alpha kinase 1 (E2AK1)
orb3009870-01 20 µg

Recombinant Human Eukaryotic translation initiation factor 2-alpha kinase 1 (E2AK1)

Sign In for Pricing
View Details
Recombinant Human Eukaryotic translation initiation factor 2-alpha kinase 1 (E2AK1)
orb3009870-02 100 µg

Recombinant Human Eukaryotic translation initiation factor 2-alpha kinase 1 (E2AK1)

Sign In for Pricing
View Details
Recombinant Human Eukaryotic translation initiation factor 2-alpha kinase 1 (E2AK1)
orb3009870-03 1 mg

Recombinant Human Eukaryotic translation initiation factor 2-alpha kinase 1 (E2AK1)

Sign In for Pricing
View Details
Smad2 (Phospho Ser255) Antibody
A9755-01 50 μL

Smad2 (Phospho Ser255) Antibody

Sign In for Pricing
View Details