Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5B2 (OR5B2)

This Recombinant Human Olfactory receptor 5B2 (OR5B2) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 5B2, OST073, Olfactory receptor OR11-240

UniProt

Q96R09

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENCTEVTKFILLGLTSVPELQIPLFILFTFIYLLTLCGNLGMMLLILMDSCLHTPMYFF LSNLSLVDFGYSSAVTPKVMAGFLRGDKVISYNACAVQMFFFVALATVENYLLASMAYDR YAAVCKPLHYTTTMTASVGACLALGSYVCGFLNASFHIGGIFSLSFCKSNLVHHFFCDVP AVMALSCSDKHTSEVILVFMSSFNIFFVLLVIFISYLFIFITILKMHSAKGHQKALSTCA SHFTAVSVFYGTVIFIYLQPSSSHSMDTDKMASVFYAMIIPMLNPVVYSLRNREVQNAFK KVLRRQKFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS53 Antibody
KC-2826-01 50 μL

VPS53 Antibody

Sign In for Pricing
View Details
VPS53 Antibody
KC-2826-02 100 µL

VPS53 Antibody

Sign In for Pricing
View Details
VPS53 Antibody
KC-2826-03 1 mL

VPS53 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS700167 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3243), CF405S conjugate, 0.1mg/mL
BNC043243-500 1x 500 µL

Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3243), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BAG3 Antibody
KC-3027-01 50 μL

BAG3 Antibody

Sign In for Pricing
View Details