Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 5B2 (OR5B2)

This Recombinant Human Olfactory receptor 5B2 (OR5B2) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 5B2, OST073, Olfactory receptor OR11-240

UniProt

Q96R09

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENCTEVTKFILLGLTSVPELQIPLFILFTFIYLLTLCGNLGMMLLILMDSCLHTPMYFF LSNLSLVDFGYSSAVTPKVMAGFLRGDKVISYNACAVQMFFFVALATVENYLLASMAYDR YAAVCKPLHYTTTMTASVGACLALGSYVCGFLNASFHIGGIFSLSFCKSNLVHHFFCDVP AVMALSCSDKHTSEVILVFMSSFNIFFVLLVIFISYLFIFITILKMHSAKGHQKALSTCA SHFTAVSVFYGTVIFIYLQPSSSHSMDTDKMASVFYAMIIPMLNPVVYSLRNREVQNAFK KVLRRQKFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Soft tissue
CS709548 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (CDX2/2214), CF568 conjugate, 0.1mg/mL
BNC682214-500 1x 500 µL

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (CDX2/2214), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p95 NBS1 (NBN) Rabbit Polyclonal Antibody
AP06274PU-N 100 µg

p95 NBS1 (NBN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GGH Recombinant Rabbit Monoclonal Antibody [JE61-78]
HA721359 100 µL

GGH Recombinant Rabbit Monoclonal Antibody [JE61-78]

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS708137 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
Recombinant Tlr2 Antibody
RC-4063-01 50 μL

Recombinant Tlr2 Antibody

Sign In for Pricing
View Details