Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 8U1 (OR8U1)

This Recombinant Human Olfactory receptor 8U1 (OR8U1) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 8U1

UniProt

Q8NH10

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAHINCTQATEFILVGLTDHQELKMPLFVLFLSIYLFTVVGNLGLILLIRADTSLNTPMY FFLSNLAFVDFCYSSVITPKMLGNFLYKQNVISFDACATQLGCFLTFMISESLLLASMAY DRYVAICNPLLYMVVMTPGICIQLVAVPYSYSFLMALFHTILTFRLSYCHSNIVNHFYCD DMPLLRLTCSDTRFKQLWIFACAGIMFISSLLIVFVSYMFIISAILRMHSAEGRQKAFST CGSHMLAVTIFYGTLIFMYLQPSSSHALDTDKMASVFYTVIIPMLNPLIYSLQNKEVKEA LKKIIINKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERINC2 (NM_018565) Human Over-expression Lysate
LY434248 100 µg

SERINC2 (NM_018565) Human Over-expression Lysate

Sign In for Pricing
View Details
Human H2AZ2 activation kit by CRISPRa
GA114341 1 Kit

Human H2AZ2 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Esophagus
CS500989 5x 5 µm

Frozen Tissue Sections, Esophagus

Sign In for Pricing
View Details
CD62L (L-Selectin) (LAM1-116), 1mg/mL
BNUM1587-50 1x 50 µL

CD62L (L-Selectin) (LAM1-116), 1mg/mL

Sign In for Pricing
View Details
Di-O-benzoyl L-Tartaric Acid
TRC-D417326-5G 5 g

Di-O-benzoyl L-Tartaric Acid

Sign In for Pricing
View Details
BRCA1 (Breast Marker) (BRCA1/1398), CF405S conjugate, 0.1mg/mL
BNC041398-500 1x 500 µL

BRCA1 (Breast Marker) (BRCA1/1398), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details