Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4C12 (OR4C12)

This Recombinant Human Olfactory receptor 4C12 (OR4C12) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 4C12, Olfactory receptor OR11-259

UniProt

Q96R67

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKKKNVTEFILIGLTQNPIMEKVTFVVFLVLYMITLSGNLLIVVTITTSQALSSPMYFF LTHLSLIDTVYSSSSAPKLIVDSFQEKKIISFNGCMAQAYAEHIFGATEIILLTVMACDC YVAICKPLNYTTIMSHSLCILLVAVAWVGGFLHATIQILFTVWLPFCGPNVIGHFMCDLY PLLKLVCIDTHTLGLFVAVNSGFICLLNFLILVVSYVIILRSLKNNSLEGRCKALSTCIS HIIVVVLFFVPCIFVYLRSVTTLPIDKAVAVFYTMVVPMLNPVVYTLRNAEVKSAIRKLW RKKVTSDND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 500 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802R-01 20 Tests

Elab Fluor® Violet 500 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802R-02 100 Tests

Elab Fluor® Violet 500 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802R-03 2x 100 Tests

Elab Fluor® Violet 500 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), 1 mg/mL
BNUM1930-50 1x 50 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), 1 mg/mL

Sign In for Pricing
View Details
PTH (Parathyroid Hormone) (N & C Terminal) (3H9 + PTH/1175), CF405S conjugate, 0.1mg/mL
BNC041236-500 1x 500 µL

PTH (Parathyroid Hormone) (N & C Terminal) (3H9 + PTH/1175), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SAG Antibody
OC-467-01 50 μL

SAG Antibody

Sign In for Pricing
View Details