Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2G3 (OR2G3)

This Recombinant Human Olfactory receptor 2G3 (OR2G3) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 2G3, Olfactory receptor OR1-33

UniProt

Q8NGZ4

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLGNESSLMDFILLGFSDHPRLEAVLFVFVLFFYLLTLVGNFTIIIISYLDPPLHTPMY FFLSNLSLLDICFTTSLAPQTLVNLQRPKKTITYGGCVAQLYISLALGSTECILLADMAL DRYIAVCKPLHYVVIMNPRLCQQLASISWLSGLASSLIHATFTLQLPLCGNHRLDHFICE VPALLKLACVDTTVNELVLFVVSVLFVVIPPALISISYGFITQAVLRIKSVEARHKAFST CSSHLTVVIIFYGTIIYVYLQPSDSYAQDQGKFISLFYTMVTPTLNPIIYTLRNKDMKEA LRKLLSGKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (C31.3), CF594 conjugate, 0.1mg/mL
BNC940049-100 1x 100 µL

CD31 / PECAM-1 (C31.3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(1S,3R)-Inpyrfluxam-hydroxy
TRC-I618390-25MG 25 mg

(1S,3R)-Inpyrfluxam-hydroxy

Sign In for Pricing
View Details
Recombinant Mouse Ephrin-A3/EFNA3 Protein (Fc Tag)
PKSM041008-01 10 µg

Recombinant Mouse Ephrin-A3/EFNA3 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse Ephrin-A3/EFNA3 Protein (Fc Tag)
PKSM041008-02 50 µg

Recombinant Mouse Ephrin-A3/EFNA3 Protein (Fc Tag)

Sign In for Pricing
View Details
TSTD3 (NM_001195131) Human Over-expression Lysate
LC433936 20 µg

TSTD3 (NM_001195131) Human Over-expression Lysate

Sign In for Pricing
View Details
CD45RA (PTPRC/1148), CF647 conjugate, 0.1mg/mL
BNC471148-500 1x 500 µL

CD45RA (PTPRC/1148), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details