Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2G3 (OR2G3)

This Recombinant Human Olfactory receptor 2G3 (OR2G3) spans the amino acid sequence from region 1-309.

Product Specifications

Product Name Alternative

Olfactory receptor 2G3, Olfactory receptor OR1-33

UniProt

Q8NGZ4

Expression Region

1-309

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLGNESSLMDFILLGFSDHPRLEAVLFVFVLFFYLLTLVGNFTIIIISYLDPPLHTPMY FFLSNLSLLDICFTTSLAPQTLVNLQRPKKTITYGGCVAQLYISLALGSTECILLADMAL DRYIAVCKPLHYVVIMNPRLCQQLASISWLSGLASSLIHATFTLQLPLCGNHRLDHFICE VPALLKLACVDTTVNELVLFVVSVLFVVIPPALISISYGFITQAVLRIKSVEARHKAFST CSSHLTVVIIFYGTIIYVYLQPSDSYAQDQGKFISLFYTMVTPTLNPIIYTLRNKDMKEA LRKLLSGKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B4GALNT4 Human Gene Knockout Kit (CRISPR)
KN224753LP 1 Kit

B4GALNT4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Csf2 Mouse Gene Knockout Kit (CRISPR)
KN503887 1 Kit

Csf2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(Z)-10-Tritriacontene
TRC-T456820-250MG 250 mg

(Z)-10-Tritriacontene

Sign In for Pricing
View Details
S6K1 (RPS6KB1) pSer447 Rabbit Polyclonal Antibody
AP20854PU-N 100 µg

S6K1 (RPS6KB1) pSer447 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KDM1A Human Gene Knockout Kit (CRISPR)
KN208480LP 1 Kit

KDM1A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Skin
CS805367 5x 5 µm

Tissue FFPE Sections, Skin

Sign In for Pricing
View Details